PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009605047.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 1014aa    MW: 111714 Da    PI: 5.5501
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009605047.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.43.3e-29614665152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  XP_009605047.1 614 AEKTISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 665
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.621599685IPR003035RWP-RK domain
PfamPF020423.4E-26617665IPR003035RWP-RK domain
PROSITE profilePS5174523.8099191001IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.2E-259191000No hitNo description
SuperFamilySSF542774.25E-229191005No hitNo description
SMARTSM006668.2E-239191001IPR000270PB1 domain
CDDcd064077.73E-389201000No hitNo description
PfamPF005642.2E-169201000IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1014 aa     Download sequence    Send to blast
MSEPEEEMNH MFRSKPKDFL PRPPPTQHTV AAENQNQREP SLMMDLDLDL DASWSFDQIF  60
AAAAASNNPM SPFLVSTTAS EQPCSPLWAF SDENEDNKPS TGNAISAASL RLSSYPRFLT  120
YTGDHEAAAE TLSVADDKKR IPLPIMGLTP LDYLDGSCII KERMTQALRY LKESTGERVL  180
AQVWAPVKNG GRYMLTTSGQ PFVLDPDCNG LHQYRMVSLM YMFAVDGETD GVLGLPGRVY  240
RKKLPEWTPN VQYYSSKEFP RLNHALHYNV RGTLALPVFE PSGQSCVGVL EIIMTSQKIN  300
YAPEVDRVCK ALEAVNLKSS EILDHQNTQI CNEGRQNALV EILEILTAVC ETYKLPLAQT  360
WVPCRHRSVL ADGGGLKKSC SSFDGSCMGQ VCMSTTDVSF YVVDAHMWGF REACAEHHLQ  420
KGQGVAGRAY ASQKSCFCED IRLFCKTEYP LVHYARLFGL SSCFAICLRS TYTGNDDYIL  480
EFFLPPNDGD YNDQLALLNS LLLTMKQHFR SLRVASGEEL EHDWGSVEVI KASMEDKLGS  540
RLESVPTTKS PPQPASVVNG RVPPDLMEEQ QAPVELNVAK VAEGVNGTAE AHNHASFSEN  600
KGTGKKSERK RGKAEKTISL EVLQQYFAGS LKDAAKSLGV CPTTMKRICR QHGISRWPSR  660
KINKVNRSLS KLKRVIESVQ GADGTFSLTS LAPNSLPVAV GSISWPAGMN GSPCNASEYH  720
EEKNELSNHG IPGSHEEAEP SNQMMESRII GNEELSPKQN GFVREGSHRS RTGSGSREES  780
AGTPTSHGSC QGSPFHANES SPQNELVNSP TQELSVKVGG SSEPARQTTG EINLSTAFLM  840
PGPYIPEHTQ QLFGGMLVED AGSSHDLRNL CPAGDAMFDD RVPEYSWTNP PCSNGIAKDQ  900
VSLPAEKMPQ FSTRPEVMSI TIKATYREDI IRFRLLLSSG IFMLKEEVAK RLKLEVGTFD  960
IKYLDDDHEW VLIACDADLQ ECVDISRSSG SNVVRLLVHD IMPNLGSSCE SSGE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009605047.10.0PREDICTED: protein NLP7
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLM1AWK00.0M1AWK0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000319450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52232239
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7